Steve Weir Landscaping

Forty years of experience installing walks, patios and walls. Free estimated.

Middlesex County

Jessie Castellano

Boston Metropolitan Area

Sudbury

Massachusetts

Teach your kids they can achieve the impossible!

Mindsee.it

Featured in the Telepathy Tapes podcast.  Mindsee.It is a quick and mind-blowing tutoring program for children that teaches them to see through a blindfold - really!    

New York County

Miranda Levingston

New York City Metropolitan Area

Upper East Side

New York

Featured in the Telepathy Tapes podcast. Mindsee.It is a quick and mind-blowing tutoring program for children that teaches them to see through a...

Stronger skills in Math and Reading, one step at a time!

Kumon Math and Reading, Natick

Math that builds skills step-by-step, until confidence shines. Reading that sparks curiosity, comprehension, and a love for words. Together, they create independent learners ready for any challenge. We at Kumon Natick believe every child can shine. So, we help them to maximize their potential. Kumon Math and Reading programs build strong foundations step by step. With daily practice, children master skills at their own pace, gaining confidence and independence. Math sharpens logic, Reading expands comprehension, and together they nurture lifelong learners prepared for success in school and beyond. Enrolling Now!

Montana Samuels

Natick

Math that builds skills step-by-step, until confidence shines. Reading that sparks curiosity, comprehension, and a love for words. Together, they...

Text 8572269140 to Book Repairs, Services & Upgrades

Denommee Plumbing, HVAC & Electric

Over Four Generations of Reliable 5-Star Quality Service Experience peace of mind with Denommee’s licensed team of plumbers, electricians, and HVAC technicians. We are the trusted, local pros that provide expert service for residential and commercial plumbing, central air systems, furnaces, boilers, air source heat pumps, ductless mini-splits, electrical wiring, outlets, and water heaters. From upgrades to new installations, we make the process simple with financing options and rebate assistance, ensuring high-quality solutions at a fair price. Plumbing Services We handle everything from fixing leaks and clearing drains to installing new fixtures and upgrading water heaters, ensuring your homes plumbing system runs smoothly. Heating &amp; Air Conditioning Services We provide comprehensive heating and cooling system services to keep your home or business as comfortable and energy efficient as possible in every season. Electrical Services Count on us for safe and professional electrical solutions, from troubleshooting to installations and upgrades. Electrification Experts As a trusted member of the Mass Save Heat Pump Installer Network (HPIN), as well as Heat Pump Water Heater pros, Electric Vehicle EVITP approved contractors, we are program-vetted experts who can help you access the maximum heat pump rebates (including $10,000 instantly) and 0% financing options from the Sponsors of Mass Save for qualifying system upgrades as well as available Heat Pump Water Heater and EV Charger installation rebates from Mass Save and National Grid. We offer complete, customizable whole home Service Program Memberships! Scheduling Made Easy Book online, or simply text 8572269140 to quick and easily schedule system maintenances, repairs and request system upgrade quotes through text messaging. Available 24/7. Standard data rates apply.

MA Patch Team

Chelmsford

 Over Four Generations of Reliable 5-Star Quality Service Experience peace of mind with Denommee’s licensed team of plumbers, electricians, and...

<a href="https://sudbury.ma.us/assessors/2021/12/13/property-data-inspections/" rel="nofollow" target="_blank">Press release from the Town of Sudbury:</a> December 13, 2021The Sudbury Assessing Department is in the process of updating our property photo inventory. In conjunction with Sudbury's data collection program, a department representative will be in Sudbury neighborhoods taking exterior photos of properties. This phase of the project does not include interior inspections. Please do not hesitate contact our office with questions or concerns regarding this program. <a data-scrambled data-to="wysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgycgerrycwysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgyc" data-salt="wysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgyc" data-domain="sudbury.ma.us" href="mailto:webmaster@sudbury.ma.us" data-text="wysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgycgerryc@sudbury.ma.uswysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgyc" rel="nofollow" target="_blank">webmaster@sudbury.ma.us</a> 978-639-3395. We thank you and appreciate your anticipated cooperation.<hr /> This press release was produced by <a href="https://sudbury.ma.us/" rel="nofollow" target="_blank">the Town of Sudbury</a>. The views expressed here are the author's own.

<a href="https://sudbury.ma.us/assessors/2021/12/13/property-data-inspections/" rel="nofollow" target="_blank">Press release from the Town of Sudbury:</a>

December 13, 2021The Sudbury Assessing Department is in the process of updating our property photo inventory. In conjunction with Sudbury’s data collection program, a department representative will be in Sudbury neighborhoods taking exterior photos of properties. This phase of the project does not include interior inspections.

Please do not hesitate contact our office with questions or concerns regarding this program. <a data-scrambled data-to="wysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgycgerrycwysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgyc" data-salt="wysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgyc" data-domain="sudbury.ma.us" href="mailto:webmaster@sudbury.ma.us" data-text="wysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgycgerryc@sudbury.ma.uswysfztfeyhwamoqhsnpjhmiokdowuannvdjlwezkigegjjuzmjhenfuvwstaesjogkcgjzbwyypddhzhzxsacldqsnytcqkkyfkspgyc" rel="nofollow" target="_blank">webmaster@sudbury.ma.us</a> 978-639-3395. We thank you and appreciate your anticipated cooperation.

<hr /> This press release was produced by <a href="https://sudbury.ma.us/" rel="nofollow" target="_blank">the Town of Sudbury</a>. The views expressed here are the author’s own.